PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01611.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 334aa    MW: 38420.7 Da    PI: 4.6937
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01611.1_g00008.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.32.1e-5581371129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeelv +yL+kk++++k++l +vi+++d+y++ePwdL+ k    ++e++ewyfFs++dkky+tg+r+nrat +g+W
  Sme2.5_01611.1_g00008.1   8 VPPGFRFHPTDEELVGYYLRKKIASQKIDL-DVIRDIDLYRIEPWDLQdKcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFW 92 
                              69****************************.9***************943432233667*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk+v++ k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  Sme2.5_01611.1_g00008.1  93 KATGRDKAVYN-KSKLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 137
                              ***********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-575142IPR003441NAC domain
PROSITE profilePS5100554.6158166IPR003441NAC domain
PfamPF023659.9E-299136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MDTNESCVPP GFRFHPTDEE LVGYYLRKKI ASQKIDLDVI RDIDLYRIEP WDLQDKCRIG  60
YEEQNEWYFF SHKDKKYPTG TRTNRATMAG FWKATGRDKA VYNKSKLIGM RKTLVFYKGR  120
APNGQKSDWI MHEYRLESEE NGPPQARQTK SNNMVEGWES NYFYDEATTT VSSIVDPLEY  180
ITRQPPPPSN NFNMVQNNLL CKQEISMEAA ENNLKFSYTN SDQFIQLPQL ESPSLPLLKR  240
PISSMSLVSD NNNNNNNHED DGSKNVTADW RALDKFVASQ LSHEESTLYE DDDHNCSDLG  300
MLLLLSDRGE GPKLNEILSS SSEDCDIGVC LFDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-48813615140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327761e-167AC232776.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02SLm0132H19, complete sequence.
GenBankHG9755141e-167HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340711.10.0PREDICTED: NAC domain-containing protein 37
SwissprotQ9SL411e-142NAC37_ARATH; NAC domain-containing protein 37
TrEMBLM0ZVN60.0M0ZVN6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000091360.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-129vascular related NAC-domain protein 1